PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI07G08780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 354aa    MW: 38375.3 Da    PI: 9.6296
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI07G08780.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.2e-1794140148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEde l + v+ +G + W+ Ia+ ++ gR +kqc++rw ++l
  ORUFI07G08780.1  94 KGGWTREEDEVLRQMVRHHGDRKWAEIAKSLP-GRIGKQCRERWTNHL 140
                      688*****************************.************996 PP

2Myb_DNA-binding56.66e-18146188145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +g WT+eEd +l++a++ +G++ W++Iar ++ gR+++ +k+rw+
  ORUFI07G08780.1 146 KGIWTEEEDRKLIKAHQTYGNR-WSAIARSLP-GRSENTVKNRWN 188
                      678*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.58189144IPR017930Myb domain
SuperFamilySSF466899.33E-3191187IPR009057Homeodomain-like
SMARTSM007172.8E-1693142IPR001005SANT/Myb domain
PfamPF002491.1E-1594140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2596145IPR009057Homeodomain-like
CDDcd001673.73E-1697140No hitNo description
PROSITE profilePS5129418.567145195IPR017930Myb domain
SMARTSM007171.3E-17145193IPR001005SANT/Myb domain
PfamPF002492.3E-16146188IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-23146192IPR009057Homeodomain-like
CDDcd001675.81E-15149191No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MATDRMPDSH FMASSNGGAC YQNTHGTPIT MGVPNLGCLV ASIGIAPSSS LMPERGLATA  60
NYNLVANFPE DAAVVPQQQQ LQAASSNSNS GLIKGGWTRE EDEVLRQMVR HHGDRKWAEI  120
AKSLPGRIGK QCRERWTNHL HPDIKKGIWT EEEDRKLIKA HQTYGNRWSA IARSLPGRSE  180
NTVKNRWNAT KRSLNSKRRL RKKNNEQAVP RQPSLLEEYI RSCQHPLPNE TAPPASFDIG  240
GYGTGGTIGA SPTPPTVHAL GGSTPLGLVM FLDLLNQATP HPPQPDLNLL NITPVYGQLP  300
VQPHGISAQV GPSNVGTSGR TGGMDNNGVI QMASNQFVMP SEGGGIPDMA RWIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-39921965110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0037380.0AP003738.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1058_C08.
GenBankAP0037540.0AP003754.5 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1341_A08.
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.11e-175PREDICTED: transcription factor RAX1-like
TrEMBLA0A0E0Q6490.0A0A0E0Q649_ORYRU; Uncharacterized protein
STRINGLOC_Os07g14110.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-44myb domain protein 98